Structure of PDB 4qlc Chain E

Receptor sequence
>4qlcE (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
ChainE
Resolution3.503 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 G44 V46 R49 K56 R63 K64 L65 P66 R69 R83 H2 R3 Y4 G7 V9 R12 K19 R26 K27 L28 P29 R32 R46 PDBbind-CN: Kd=0.35uM
BS02 dna E Y41 R42 P43 T45 R63 R83 F84 Q85 R116 V117 T118 M120 Y4 R5 P6 T8 R26 R46 F47 Q48 R79 V80 T81 M83 PDBbind-CN: Kd=0.35uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum4qlc
PubMed26212454
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]