Structure of PDB 4qd9 Chain E |
>4qd9E (length=139) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
SLWRQTPDLEQLNASQKNSIGDLLGIRFEAFDDESLTASMPVDSRTHQPF GLLHGGASVVLAESLGSMASYLCVDTSQYYCVGLEVNANHLRGLRSGRVT AVARAIHLGRTTHVWDIRLSGDDGKPSCIARLTMAVVPL |
|
PDB | 4qd9 Design and Use of an Ester Analog of CoA to Trap the Michaelis Complex in a Thioesterase |
Chain | E |
Resolution | 1.767 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
31B |
E |
E64 S68 G84 |
E63 S67 G83 |
|
|
|
|