Structure of PDB 4q9n Chain E

Receptor sequence

>4q9nE (length=295) Species: 1340853 (Chlamydia trachomatis F/11-96)

MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFS
QSLELGKFNASRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKD
LSGYTVSEVVEQVKKHFGHIDILVHSLANSPEIAKPLLDTSRKGYLAALS
TSSYSFISLLSHFGPIMNAGASTISLTYLASMRAVPGYGGGMNAAKAALE
SDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERMVDYYQDWAPL
PSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMF

3D structure

• PDB: 4q9n Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.
• Chain: E
• Resolution: 1.795 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	E	G21 Y22 W42 D79 A80 S126 L127 A128 L176 T177 K196 P225 L226 S228 A230	G21 Y22 W42 D79 A80 S126 L127 A128 L176 T177 K196 P225 L226 S228 A230
BS02	0WE	E	N129 S130 I133 Y178 G187 Y188 A230 A233 I234 F236	N129 S130 I133 Y178 G187 Y188 A230 A233 I234 F236	MOAD: ic50=0.95uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 11:46:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4q9n', asym_id = 'E', title = 'Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4q9n', asym_id='E', title='Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '4q9n', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='4q9n', asym_id='E')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>