Structure of PDB 4oo1 Chain E

Receptor sequence

>4oo1E (length=255) Species: 559292 (Saccharomyces cerevisiae S288C)

SLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRII
ASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNK
VLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNS
TYLPKLISAFPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVA
NNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVV
RSLEN

3D structure

• PDB: 4oo1 Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
• Chain: E
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	E	D81 Q85	D80 Q84

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0035925 mRNA 3'-UTR AU-rich region binding

Biological Process

• GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
• GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006401 RNA catabolic process
• GO:0016075 rRNA catabolic process
• GO:0034473 U1 snRNA 3'-end processing
• GO:0034475 U4 snRNA 3'-end processing
• GO:0034476 U5 snRNA 3'-end processing
• GO:0071028 nuclear mRNA surveillance
• GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
• GO:0071038 TRAMP-dependent tRNA surveillance pathway

Cellular Component

• GO:0000176 nuclear exosome (RNase complex)
• GO:0000177 cytoplasmic exosome (RNase complex)
• GO:0000178 exosome (RNase complex)
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:4oo1, PDBe:4oo1, PDBj:4oo1
• PDBsum: 4oo1
• PubMed: 25043052
• UniProt: Q12277|RRP42_YEAST Exosome complex component RRP42 (Gene Name=RRP42)