Structure of PDB 4mvj Chain E

Receptor sequence

>4mvjE (length=331) Species: 536056 (Escherichia coli DH1)

MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDST
HGRFDGTVEVKDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLF
LTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAGQDIVSNASC
TTNCLAPLAKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGA
SQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTVRLEKA
ATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK

3D structure

• PDB: 4mvj Structural, kinetic and proteomic characterization of acetyl phosphate-dependent bacterial protein acetylation.
• Chain: E
• Resolution: 2.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	E	G11 R12 I13 D34 T97 T120 C150 A181 N314	G11 R12 I13 D34 T97 T120 C150 A181 N314

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat May 10 10:07:20 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1472         else:

=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1474     

   1475     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4mvj', asym_id = 'E', title = 'Structural, kinetic and proteomic characterizati...hosphate-dependent bacterial protein acetylation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4mvj', asym_id='E', title='Structural, kinetic and proteomic characterizati...hosphate-dependent bacterial protein acetylation.')

    840 

    841     if go:

=>  842         display_go(go,uniprot,pdbid,asym_id)

    843     return pubmed,uniprot

    844 

global display_go = <function display_go>, go = '0006006,0016620,0050661,0051287', uniprot = '', pdbid = '4mvj', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006006,0016620,0050661,0051287', uniprot='', pdbid='4mvj', asym_id='E')

    481         '''.replace("$namespace_link",namespace_link

    482           ).replace("$namespace",namespace

=>  483           ).replace("$uniprot",u

    484         ))

    485         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>