Structure of PDB 4m2x Chain E

Receptor sequence

>4m2xE (length=159) Species: 1773 (Mycobacterium tuberculosis)

MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSL
PAKVRPLPGRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVY
ALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLR
YRLYSYHRS

3D structure

• PDB: 4m2x Selective inhibitors for dihydrofolate reductase from mycobacterium tuberculosis
• Chain: E
• Resolution: 2.26 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T91 T113
• Catalytic site (residue number reindexed from 1): T91 T113
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	E	W6 A7 I14 G15 G18 D19 I20 G43 R44 R45 T46 S49 L65 S66 R67 Q68 I94 G95 G96 G97 Q98 V99 A126	W6 A7 I14 G15 G18 D19 I20 G43 R44 R45 T46 S49 L65 S66 R67 Q68 I94 G95 G96 G97 Q98 V99 A126
BS02	TMQ	E	I5 W6 A7 I20 R23 D27 Q28 F31 P51 I94	I5 W6 A7 I20 R23 D27 Q28 F31 P51 I94

Gene Ontology

Molecular Function

• GO:0004146 dihydrofolate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding
• GO:0070401 NADP+ binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0046452 dihydrofolate metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046655 folic acid metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4m2x, PDBe:4m2x, PDBj:4m2x
• PDBsum: 4m2x
• UniProt: P9WNX1|DYR_MYCTU Dihydrofolate reductase (Gene Name=folA)