Structure of PDB 4k4b Chain E

Receptor sequence
>4k4bE (length=136) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPF
GLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRG
VCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL
3D structure
PDB4k4b Structure and Catalysis in the Escherichia coli Hotdog-fold Thioesterase Paralogs YdiI and YbdB.
ChainE
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.2.28: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UOQ E V42 D43 S44 P49 E95 G96 V42 D43 S44 P49 E95 G96 MOAD: Ki=12.2uM
BS02 UOQ E H106 G108 S109 R110 H111 H106 G108 S109 R110 H111 MOAD: Ki=12.2uM
BS03 UOQ E Q48 P49 H54 G55 H89 V90 R91 Q48 P49 H54 G55 H89 V90 R91 MOAD: Ki=12.2uM
BS04 UOQ E V21 E63 S67 V21 E63 S67 MOAD: Ki=12.2uM
Gene Ontology
Molecular Function
GO:0016289 acyl-CoA hydrolase activity
GO:0016787 hydrolase activity
GO:0016790 thiolester hydrolase activity
GO:0061522 1,4-dihydroxy-2-naphthoyl-CoA thioesterase activity
Biological Process
GO:0009234 menaquinone biosynthetic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k4b, PDBe:4k4b, PDBj:4k4b
PDBsum4k4b
PubMed25010423
UniProtP77781|MENI_ECOLI 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Gene Name=menI)

[Back to BioLiP]