Structure of PDB 4j8x Chain E

Receptor sequence
>4j8xE (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB4j8x Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
ChainE
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna E H39 R40 Y41 P43 G44 V46 R49 R63 K64 L65 P66 R69 R83 H2 R3 Y4 P6 G7 V9 R12 R26 K27 L28 P29 R32 R46
BS02 dna E R40 Y41 R42 P43 T45 R72 R83 F84 Q85 S86 V117 T118 R3 Y4 R5 P6 T8 R35 R46 F47 Q48 S49 V80 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4j8x, PDBe:4j8x, PDBj:4j8x
PDBsum4j8x
PubMed
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]