Structure of PDB 4j8v Chain E

Receptor sequence
>4j8vE (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB4j8v Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
ChainE
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 G44 V46 A47 R49 R63 K64 L65 R69 R83 H2 R3 Y4 G7 V9 A10 R12 R26 K27 L28 R32 R46
BS02 dna E R40 Y41 R42 P43 T45 R72 R83 F84 Q85 S86 R116 V117 T118 R3 Y4 R5 P6 T8 R35 R46 F47 Q48 S49 R79 V80 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4j8v, PDBe:4j8v, PDBj:4j8v
PDBsum4j8v
PubMed
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]