Structure of PDB 4ihb Chain E |
>4ihbE (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] |
FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEG FEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSA SFNAPLLDTKKQPTGASLVLQVSYTA |
|
PDB | 4ihb Alternate Splicing of Dysferlin C2A Confers Ca(2+)-Dependent and Ca(2+)-Independent Binding for Membrane Repair. |
Chain | E |
Resolution | 2.044 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
E |
D18 I19 D21 N40 |
D19 I20 D22 N41 |
|
|
|