Structure of PDB 4i4z Chain E

Receptor sequence

>4i4zE (length=275) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa)

MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAR
EDNRIGVVLLTGAGPHSDGKYAFCSGGDQSVRGEGGYIDDQGTPRLNVLD
LQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVG
SFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRL
EEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMT
EEGSEGKQAFLEKRPPDFSQYPWLP

3D structure

• PDB: 4i4z Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme a synthase from the crotonase fold superfamily
• Chain: E
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G77 R82 Y87 R95 L99 G123 V126 G146 S151 D153 G154 A240 Y248
• Catalytic site (residue number reindexed from 1): G77 R82 Y87 R95 L99 G123 V126 G146 S151 D153 G154 A240 Y248
• Enzyme Commision number: 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2NE	E	F260 K263	F260 K263
BS02	2NE	E	H29 K30 R31 A33 S75 G76 G77 D78 Q79 Y87 V98 Y119 G123 T145 V149 S151	H29 K30 R31 A33 S75 G76 G77 D78 Q79 Y87 V98 Y119 G123 T145 V149 S151
BS03	BCT	E	G122 Q144 T145 G146 W174	G122 Q144 T145 G146 W174

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008935 1,4-dihydroxy-2-naphthoyl-CoA synthase activity
• GO:0016829 lyase activity

Biological Process

• GO:0009234 menaquinone biosynthetic process
• GO:0042372 phylloquinone biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4i4z, PDBe:4i4z, PDBj:4i4z
• PDBsum: 4i4z
• PubMed: 23658663
• UniProt: P73495