Structure of PDB 4hqb Chain E |
>4hqbE (length=128) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
TMLQIEFITDLGARVTVNVEHESRLLDVQRHYGRLGWTSGEIPSGGYQFP IENEADFDWSLIGARKWKSPEGEELVIHRGHAYRRRELEAVDSRKLKLPA AIKYSRGEYVSLAIFRGGKRQERYAVPG |
|
PDB | 4hqb Crystal structure of the DdrB/ssDNA complex from Deinococcus radiodurans reveals a DNA binding surface involving higher-order oligomeric states. |
Chain | E |
Resolution | 2.301 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
E |
G134 Q137 |
G118 Q121 |
PDBbind-CN: Kd=3.6uM |
|
|