Structure of PDB 4h44 Chain E

Receptor sequence
>4h44E (length=31) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
MLAIVAYIGFLALFTGIAAGLLFGLRSAKIL
3D structure
PDB4h44 Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
ChainE
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E A3 Y7 F10 L11 F14 T15 A3 Y7 F10 L11 F14 T15
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h44, PDBe:4h44, PDBj:4h44
PDBsum4h44
PubMed23440205
UniProtQ8YVQ2|PETL_NOSS1 Cytochrome b6-f complex subunit 6 (Gene Name=petL)

[Back to BioLiP]