Structure of PDB 4h3k Chain E

Receptor sequence
>4h3kE (length=190) Species: 9606 (Homo sapiens) [Search protein sequence]
PLRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNV
YDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDL
FDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFL
ICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
3D structure
PDB4h3k An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
ChainE
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E S12 S13 S14 N15 Q16 N17 R18 T40 K43 L44 P45 G46 P47 A48 P49 M84 R114 D143 S8 S9 S10 N11 Q12 N13 R14 T36 K39 L40 P41 G42 P43 A44 P45 M80 R110 D139
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
GO:0017018 myosin phosphatase activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006369 termination of RNA polymerase II transcription
GO:0006397 mRNA processing
GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h3k, PDBe:4h3k, PDBj:4h3k
PDBsum4h3k
PubMed23070812
UniProtQ9NP77|SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (Gene Name=SSU72)

[Back to BioLiP]