Structure of PDB 4h3h Chain E

Receptor sequence
>4h3hE (length=192) Species: 9606 (Homo sapiens) [Search protein sequence]
SSPLRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKP
NVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCK
DLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGA
FLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
3D structure
PDB4h3h An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
ChainE
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E S12 S13 S14 N15 Q16 N17 R18 K43 P45 P49 P52 M84 R114 D143 H145 S10 S11 S12 N13 Q14 N15 R16 K41 P43 P47 P50 M82 R112 D141 H143
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
GO:0017018 myosin phosphatase activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006369 termination of RNA polymerase II transcription
GO:0006397 mRNA processing
GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h3h, PDBe:4h3h, PDBj:4h3h
PDBsum4h3h
PubMed23070812
UniProtQ9NP77|SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (Gene Name=SSU72)

[Back to BioLiP]