Structure of PDB 4gej Chain E |
>4gejE (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] |
KSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWM QGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQ GPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV |
|
PDB | 4gej Structure of the N-terminal domain of human thioredoxin-interacting protein. |
Chain | E |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
E |
D74 T75 |
D67 T68 |
|
|
|