Structure of PDB 4fex Chain E

Receptor sequence
>4fexE (length=254) Species: 509173 (Acinetobacter baumannii AYE) [Search protein sequence]
NLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTD
EMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSG
ENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFD
DERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDV
GRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLML
DEFF
3D structure
PDB4fex Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
ChainE
Resolution2.71 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 KAN E Q35 D165 D167 D198 R219 N234 C235 E238 D268 E269 F271 Q18 D148 D150 D181 R202 N217 C218 E221 D251 E252 F254
BS02 0TO E I40 F53 T98 A100 I101 G103 I215 I23 F36 T81 A83 I84 G86 I198
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 00:47:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4fex', asym_id = 'E', title = 'Structure-guided optimization of protein kinase ...rs reverses aminoglycoside antibiotic resistance.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4fex', asym_id='E', title='Structure-guided optimization of protein kinase ...rs reverses aminoglycoside antibiotic resistance.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005524,0016773,0046677', uniprot = '', pdbid = '4fex', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005524,0016773,0046677', uniprot='', pdbid='4fex', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>