Structure of PDB 4esv Chain E

Receptor sequence

>4esvE (length=418) Species: 1422 (Geobacillus stearothermophilus)

SIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRG
EPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEK
SVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEGAFKNIKDILVQT
YDNIEMLHNITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNI
AQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDW
GKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQ
LIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQDK
RPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGP
VGTVQLAFIKEYNKFVNL

3D structure

• PDB: 4esv The Hexameric Helicase DnaB Adopts a Nonplanar Conformation during Translocation.
• Chain: E
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.12: DNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	Q336 R381 E382 S383 G384	Q313 R358 E359 S360 G361
BS02	ALF	E	K216 E241	K193 E218
BS03	GDP	E	S213 G215 K216 T217 A218 R250 Q261 K433 N436	S190 G192 K193 T194 A195 R227 Q238 K410 N413
BS04	CA	E	T217 D320	T194 D297
BS05	ALF	E	K418 R420	K395 R397
BS06	GDP	E	Q419 N421 G422	Q396 N398 G399

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016853 isomerase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0006268 DNA unwinding involved in DNA replication
• GO:0006269 DNA replication, synthesis of primer

Cellular Component

• GO:0005829 cytosol
• GO:1990077 primosome complex

External links

• PDB: RCSB:4esv, PDBe:4esv, PDBj:4esv
• PDBsum: 4esv
• PubMed: 23022319
• UniProt: Q9X4C9|DNAB_GEOSE Replicative DNA helicase DnaB (Gene Name=dnaB)