Structure of PDB 4dv1 Chain E

Receptor sequence

>4dv1E (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG

3D structure

PDB

4dv1 A structural basis for streptomycin resistance

Chain

Resolution

3.849 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R14 T16 A17 R18 M19 Q20 A21 G22 R24 R25 R27 F45 K47 K57 Y61 A86 K92 A94 A95 T98 I101 A102 T120 K121 E122 L123 S125 R126 N127 N130 Y133	R10 T12 A13 R14 M15 Q16 A17 G18 R20 R21 R23 F41 K43 K53 Y57 A82 K88 A90 A91 T94 I97 A98 T116 K117 E118 L119 S121 R122 N123 N126 Y129

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4dv1, PDBe:4dv1, PDBj:4dv1
PDBsum	4dv1
PubMed
UniProt	Q5SHQ5\|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]