Structure of PDB 4cj8 Chain E

Receptor sequence
>4cj8E (length=246) Species: 28116 (Bacteroides ovatus) [Search protein sequence]
HMRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYD
EENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLL
FTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGE
GRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKYF
LDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQYGGHELLRRK
3D structure
PDB4cj8 Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products
ChainE
Resolution3.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UD2 E I8 C9 T10 Y13 W66 N69 R73 N95 A96 G156 G157 W189 D191 Q192 K231 R243 I9 C10 T11 Y14 W67 N70 R74 N96 A97 G157 G158 W190 D192 Q193 K232 R244
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Mar 3 04:11:44 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4cj8', asym_id = 'E', title = 'Structures of Complexes of a Metal-Independent G...atus with Udp-Galnac and its Hydrolysis Products '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4cj8', asym_id='E', title='Structures of Complexes of a Metal-Independent G...atus with Udp-Galnac and its Hydrolysis Products ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005975,0016020,0016758', uniprot = '', pdbid = '4cj8', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005975,0016020,0016758', uniprot='', pdbid='4cj8', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>