Structure of PDB 4cff Chain E

Receptor sequence
>4cffE (length=299) Species: 9606 (Homo sapiens) [Search protein sequence]
SVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWD
SKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSF
KPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFL
KLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVS
ALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV
LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT
3D structure
PDB4cff Structural Basis of Ampk Regulation by Small Molecule Activators.
ChainE
Resolution3.924 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AMP E R70 K170 I240 S242 D245 R269 V276 L277 V297 H298 R299 R44 K144 I214 S216 D219 R243 V250 L251 V271 H272 R273
BS02 AMP E H151 T200 I204 A205 V225 S226 H298 S314 S316 D317 H125 T174 I178 A179 V199 S200 H272 S288 S290 D291
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004691 cAMP-dependent protein kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008603 cAMP-dependent protein kinase regulator activity
GO:0016208 AMP binding
GO:0019887 protein kinase regulator activity
GO:0019901 protein kinase binding
GO:0043531 ADP binding
Biological Process
GO:0006110 regulation of glycolytic process
GO:0006468 protein phosphorylation
GO:0006633 fatty acid biosynthetic process
GO:0007165 signal transduction
GO:0007283 spermatogenesis
GO:0010628 positive regulation of gene expression
GO:0031669 cellular response to nutrient levels
GO:0045860 positive regulation of protein kinase activity
GO:0051170 import into nucleus
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0031588 nucleotide-activated protein kinase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cff, PDBe:4cff, PDBj:4cff
PDBsum4cff
PubMed24352254
UniProtP54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=PRKAG1)

[Back to BioLiP]