Structure of PDB 4c3k Chain E

Receptor sequence

>4c3kE (length=96) Species: 32046 (Synechococcus elongatus)

MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGREFLQKLKLEIVV
EDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA

3D structure

• PDB: 4c3k Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
• Chain: E
• Resolution: 3.099 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	E	G27 M28 T29 V64 R101 R103	G27 M28 T29 V49 R86 R88	PDBbind-CN: -logKd/Ki=4.97,Kd=10.6uM
BS02	ADP	E	I7 G35 F36 G37 R38 K58 I86 G87 K90 F92	I7 G35 F36 G37 R38 K43 I71 G72 K75 F77	PDBbind-CN: -logKd/Ki=4.97,Kd=10.6uM

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0030234 enzyme regulator activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006808 regulation of nitrogen utilization

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4c3k, PDBe:4c3k, PDBj:4c3k
• PDBsum: 4c3k
• PubMed: 24519945
• UniProt: P0A3F4|GLNB_SYNE7 Nitrogen regulatory protein P-II (Gene Name=glnB)