Structure of PDB 4c31 Chain E

Receptor sequence

>4c31E (length=92) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

DTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNIN
ESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDT

3D structure

PDB

4c31 Structural Basis for Binding the Trex2 Complex to Nuclear Pores, Gal1 Localisation and Mrna Export.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	K9 Q13 V17 Y22 E23	K6 Q10 V14 Y19 E20
BS02	peptide	E	L8 Q11 Y15 I92 V93 D94	L5 Q8 Y12 I89 V90 D91

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0003713	transcription coactivator activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity

	Biological Process
GO:0000973	post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325	chromatin organization
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0006406	mRNA export from nucleus
GO:0015031	protein transport
GO:0016973	poly(A)+ mRNA export from nucleus
GO:0032880	regulation of protein localization
GO:0045893	positive regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051028	mRNA transport
GO:0071028	nuclear mRNA surveillance

	Cellular Component
GO:0000124	SAGA complex
GO:0000932	P-body
GO:0005634	nucleus
GO:0005643	nuclear pore
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0046695	SLIK (SAGA-like) complex
GO:0070390	transcription export complex 2
GO:0071819	DUBm complex

External links

PDB	RCSB:4c31, PDBe:4c31, PDBj:4c31
PDBsum	4c31
PubMed	24705649
UniProt	Q6WNK7\|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)