Structure of PDB 4bwq Chain E

Receptor sequence
>4bwqE (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]
MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVK
NFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKIN
WAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS
3D structure
PDB4bwq Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
ChainE
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide E M4 L5 H7 W12 Q13 M1 L2 H4 W9 Q10
BS02 peptide E G11 D15 D68 F69 M72 Y73 E74 N87 H89 M91 N98 N99 N100 G8 D12 D65 F66 M69 Y70 E71 N84 H86 M88 N95 N96 N97
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4bwq, PDBe:4bwq, PDBj:4bwq
PDBsum4bwq
PubMed24781215
UniProtP83876|TXN4A_HUMAN Thioredoxin-like protein 4A (Gene Name=TXNL4A)

[Back to BioLiP]