Structure of PDB 4akb Chain E

Receptor sequence

>4akbE (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence]

GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGENHKSFITG
FTPVKISLDFPSEYIMEVSGYTGKVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFSLPIENGLIVGFKGSIGYWLDYFSMYLSL

3D structure

PDB

4akb Structures and Binding Specificity of Galactose- and Mannose-Binding Lectins from Champedak: Differences from Jackfruit Lectins

Chain

Resolution

1.95 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	E	S105 P107 I108 E109 N110 L133	S105 P107 I108 E109 N110 L133
BS02	peptide	E	T72 V79 F104 D125 Y126 F127 S128 M129 Y130 L131	T72 V79 F104 D125 Y126 F127 S128 M129 Y130 L131
BS03	peptide	E	T10 F60 P61 Y64 N110 G111 L112 L133	T10 F60 P61 Y64 N110 G111 L112 L133
BS04	GAL	E	G1 F47 Y78 G121 Y122 W123 D125	G1 F47 Y78 G121 Y122 W123 D125

Gene Ontology

	Molecular Function
GO:0019862	IgA binding
GO:0030246	carbohydrate binding

	Biological Process
GO:0008150	biological_process

	Cellular Component
GO:0005575	cellular_component

External links

PDB	RCSB:4akb, PDBe:4akb, PDBj:4akb
PDBsum	4akb
PubMed	24915077
UniProt	P18670\|LECA_ARTIN Agglutinin alpha chain