Structure of PDB 4aa6 Chain E

Receptor sequence
>4aa6E (length=68) Species: 9606 (Homo sapiens) [Search protein sequence]
RYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGDYMCPATNQCTIDKNRR
KSCQACRLRKCYEVGMMK
3D structure
PDB4aa6 The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation.
ChainE
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E Y195 H196 Y197 K206 K210 Y13 H14 Y15 K24 K28
BS02 dna E E203 A207 R211 Q238 R241 E21 A25 R29 Q54 R57
BS03 ZN E C185 C188 C202 C205 C3 C6 C20 C23
BS04 ZN E C221 C227 C237 C240 C37 C43 C53 C56
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4aa6, PDBe:4aa6, PDBj:4aa6
PDBsum4aa6
PubMed7735836
UniProtP03372|ESR1_HUMAN Estrogen receptor (Gene Name=ESR1)

[Back to BioLiP]