Structure of PDB 3w98 Chain E

Receptor sequence
>3w98E (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB3w98 Contribution of histone N-terminal tails to the structure and stability of nucleosomes
ChainE
Resolution3.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E K37 H39 R40 Y41 G44 V46 R49 R63 K64 L65 R69 R83 K1 H3 R4 Y5 G8 V10 R13 R27 K28 L29 R33 R47
BS02 dna E K37 R40 Y41 R42 P43 R63 R72 R83 F84 Q85 R116 T118 K1 R4 Y5 R6 P7 R27 R36 R47 F48 Q49 R80 T82
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3w98, PDBe:3w98, PDBj:3w98
PDBsum3w98
PubMed24251097
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]