Structure of PDB 3tu4 Chain E

Receptor sequence
>3tu4E (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB3tu4 Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
ChainE
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E Y41 R42 T45 R63 R72 R83 F84 Q85 R116 V117 T118 Y2 R3 T6 R24 R33 R44 F45 Q46 R77 V78 T79
BS02 dna E R40 Y41 G44 T45 V46 A47 R49 R63 K64 L65 P66 R69 R1 Y2 G5 T6 V7 A8 R10 R24 K25 L26 P27 R30
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3tu4, PDBe:3tu4, PDBj:3tu4
PDBsum3tu4
PubMed22096199
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]