Structure of PDB 3t94 Chain E

Receptor sequence

>3t94E (length=270) Species: 2287 (Saccharolobus solfataricus)

MIEQNEKASIGIIGGSGLYDPGIFSESKEIKVYTPYGQPSDFITIGKIGN
KSVAFLPRHGRGHRIPPHKINYRANIWALKELGVRWVISVSAVGSLRMDY
KLGDFVIPDQFIDMTKNREYSFFDGPVVAHVSMADPFCNSLRKLAIETAK
ELNIKTHESGTYICIEGPRFSTRAESRTWREVYKADIIGMTLVPEVNLAC
EAQMCYATIAMVTDYDVFAEIPVTAEEVTRVMAENTEKAKKLLYALIQKL
PEKPEEGSCSCCNSLKTALV

3D structure

• PDB: 3t94 A corrected space group for Sulfolobus sulfataricus 5'-deoxy-5'-methylthioadenosine phosphorylase II.
• Chain: E
• Resolution: 1.452 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S16 P39 H63 I65 P66 A92 M190 T191 D214 D216 A225
• Catalytic site (residue number reindexed from 1): S16 P39 H63 I65 P66 A92 M190 T191 D214 D216 A225
• Enzyme Commision number: 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MTA	E	V93 G94 F170 I188 M190 D214 A225 V228	V93 G94 F170 I188 M190 D214 A225 V228

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0017061 S-methyl-5-thioadenosine phosphorylase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0009116 nucleoside metabolic process
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3t94, PDBe:3t94, PDBj:3t94
• PDBsum: 3t94
• PubMed: 22349226
• UniProt: Q97W94|MTAP_SACS2 S-methyl-5'-thioadenosine phosphorylase (Gene Name=mtnP)