Structure of PDB 3qo3 Chain E |
>3qo3E (length=61) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
QSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV YKHAISTVVPS |
|
PDB | 3qo3 Structural and biochemical studies on ATP binding and hydrolysis by the Escherichia coli RNA chaperone Hfq |
Chain | E |
Resolution | 2.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ATP |
E |
L26 I30 L32 |
L22 I26 L28 |
|
|
|
|