Structure of PDB 3qa3 Chain E |
>3qa3E (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] |
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFR IHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARK NAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSR QELNTIASKPPRDHVFQVNNFEALKTIQNQLREKGF |
|
PDB | 3qa3 Stable Coordination of the Inhibitory Ca2+ Ion at the Metal Ion-Dependent Adhesion Site in Integrin CD11b/CD18 by an Antibody-Derived Ligand Aspartate: Implications for Integrin Regulation and Structure-Based Drug Design. |
Chain | E |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
E |
S142 S144 D242 |
S11 S13 D111 |
|
|
|