Structure of PDB 3o2q Chain E

Receptor sequence

>3o2qE (length=192) Species: 9606 (Homo sapiens)

SSPLRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKP
NVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCK
DLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGA
FLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

3D structure

• PDB: 3o2q Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
• Chain: E
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	S12 S13 S14 N15 Q16 N17 R18 K43 L44 P45 G46 P47 A48 D143	S10 S11 S12 N13 Q14 N15 R16 K41 L42 P43 G44 P45 A46 D141

Gene Ontology

Molecular Function

• GO:0004721 phosphoprotein phosphatase activity
• GO:0004722 protein serine/threonine phosphatase activity
• GO:0005515 protein binding
• GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
• GO:0017018 myosin phosphatase activity

Biological Process

• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0006369 termination of RNA polymerase II transcription
• GO:0006397 mRNA processing
• GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

External links

• PDB: RCSB:3o2q, PDBe:3o2q, PDBj:3o2q
• PDBsum: 3o2q
• PubMed: 20861839
• UniProt: Q9NP77|SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (Gene Name=SSU72)