Structure of PDB 3nvk Chain E

Receptor sequence
>3nvkE (length=121) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVI
IAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAII
EPGKARDLVEEIAMKVKELMK
3D structure
PDB3nvk Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
ChainE
Resolution3.209 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E R34 K35 T37 N38 E39 K42 V58 D59 I63 K84 V95 R31 K32 T34 N35 E36 K39 V55 D56 I60 K81 V92
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3nvk, PDBe:3nvk, PDBj:3nvk
PDBsum3nvk
PubMed20864039
UniProtQ8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]