Structure of PDB 3mgp Chain E

Receptor sequence
>3mgpE (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB3mgp Perturbations in nucleosome structure from heavy metal association.
ChainE
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna E H39 R40 Y41 P43 G44 V46 R49 R63 K64 L65 P66 R69 R83 H3 R4 Y5 P7 G8 V10 R13 R27 K28 L29 P30 R33 R47
BS02 dna E K37 R40 Y41 R42 T45 R72 R83 F84 Q85 S86 R116 V117 T118 M120 K1 R4 Y5 R6 T9 R36 R47 F48 Q49 S50 R80 V81 T82 M84
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3mgp, PDBe:3mgp, PDBj:3mgp
PDBsum3mgp
PubMed20494975
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]