Structure of PDB 3lu9 Chain E

Receptor sequence

>3lu9E (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDAGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
G

3D structure

• PDB: 3lu9 Crystal structure of thrombin bound to the uncleaved extracellular fragment of PAR1.
• Chain: E
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 A195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E195 G196 D197 A198 G199
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	F34 Q38 E39 L41 C42 H57 Y60A W60D L65 R67 R73 T74 R75 Y76 I82 E97A N98 Q151 R173 I174 D189 A190 C191 E192 G193 A195 S214 W215 G216 E217 G219	F19 Q24 E25 L27 C28 H43 Y47 W50 L60 R62 R68 T69 R70 Y71 I78 E94 N95 Q149 R171 I172 D192 A193 C194 E195 G196 A198 S219 W220 G221 E222 G223

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:3lu9, PDBe:3lu9, PDBj:3lu9
• PDBsum: 3lu9
• PubMed: 20236938
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)