Structure of PDB 3lbj Chain E

Receptor sequence
>3lbjE (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
NQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMV
YCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLV
3D structure
PDB3lbj Structures of low molecular weight inhibitors bound to MDMX and MDM2 reveal new approaches for p53-MDMX/MDM2 antagonist drug discovery
ChainE
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 WW8 E M53 L56 G57 I60 M61 Y66 Q71 V92 L98 M29 L32 G33 I36 M37 Y42 Q47 V68 L74 PDBbind-CN: -logKd/Ki=4.96,Ki=11uM
BindingDB: EC50=20000nM
BS02 WW8 E V27 V49 Y99 R103 V3 V25 Y75 R79 PDBbind-CN: -logKd/Ki=4.96,Ki=11uM
BindingDB: EC50=20000nM
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lbj, PDBe:3lbj, PDBj:3lbj
PDBsum3lbj
PubMed20237429
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]