Structure of PDB 3kzi Chain E

Receptor sequence

>3kziE (length=77) Species: 197221 (Thermosynechococcus vestitus BP-1)

RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYA
QEQRSIPLVTDRFEAKQQVETFLEQLK

3D structure

• PDB: 3kzi Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
• Chain: E
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	E	R8 I13 R18 Y19 H23 T26	R1 I6 R11 Y12 H16 T19

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:3kzi, PDBe:3kzi, PDBj:3kzi
• PDBsum: 3kzi
• PubMed: 20558739
• UniProt: Q8DIP0|PSBE_THEVB Cytochrome b559 subunit alpha (Gene Name=psbE)