Structure of PDB 3ko0 Chain E

Receptor sequence

>3ko0E (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]

ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTD
EAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGF

3D structure

PDB

3ko0 Phenothiazines inhibit S100A4 function by inducing protein oligomerization.

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	TFP	E	F89 F93	F88 F92
BS02	TFP	E	S44 F45 C86 F89	S43 F44 C85 F88
BS03	CA	E	S20 E23 D25 K28 E33	S19 E22 D24 K27 E32
BS04	CA	E	D63 N65 D67 E69 E74	D62 N64 D66 E68 E73
BS05	TFP	E	S44 F45 L46 M85 C86	S43 F44 L45 M84 C85
BS06	TFP	E	E6 D10	E5 D9
BS07	TFP	E	D10 S14	D9 S13

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003779	actin binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0042056	chemoattractant activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0046914	transition metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0001837	epithelial to mesenchymal transition
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0050918	positive chemotaxis

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0048471	perinuclear region of cytoplasm
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome

External links

PDB	RCSB:3ko0, PDBe:3ko0, PDBj:3ko0
PDBsum	3ko0
PubMed	20421509
UniProt	P26447\|S10A4_HUMAN Protein S100-A4 (Gene Name=S100A4)