Structure of PDB 3jcs Chain E

Receptor sequence

>3jcsE (length=190) Species: 5661 (Leishmania donovani) [Search protein sequence]

MVKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKK
NRTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVRCAYAHFPI
NVSVDGQNIEVRNFLGEKRVRRQLVPSSVKVSQTDPSKVKDEIIFDGNDL
EQVSREAAVLHQMCLVKKKDIRKFLDGIYVQTKTNIEGME

3D structure

PDB

3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	E	M1 S62 K63	M1 S62 K63
BS02	rna	E	K167 K169 D170 I171 R172 K173	K167 K169 D170 I171 R172 K173
BS03	rna	E	H40 A67 C68 N70 T71 A74 H75 A94 Y95 A96 H97 F98 L115 E117 K118 R119 L150 E151 R155 A158 H161 Q162 F174 L175 D176 K183	H40 A67 C68 N70 T71 A74 H75 A94 Y95 A96 H97 F98 L115 E117 K118 R119 L150 E151 R155 A158 H161 Q162 F174 L175 D176 K183

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jcs, PDBe:3jcs, PDBj:3jcs
PDBsum	3jcs
PubMed	27373148
UniProt	A0A3S7WWL2

[Back to BioLiP]