Structure of PDB 3jag Chain E

Receptor sequence

>3jagE (length=236) Species: 9986 (Oryctolagus cuniculus)

PHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYAAPVLATVTKPVGGDKNG
GTRVVKLRKMPRYYPTEDVPRKLLSHGRKPFSQHVRKLRASITPGTILII
LTGRHRGKRVVFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKID
ISGVKIPKHLTDAYFKKKQLRKPRHQEGEIFDTEKEKYEITEQRKVDQKA
VDSQILPKIKAVPQLQGYLRSVFALTNGVYPHKLVF

3D structure

• PDB: 3jag Structural basis for stop codon recognition in eukaryotes.
• Chain: E
• Resolution: 3.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	H39 C40 S41 R42 N43 P44 V47 R48 R55 S56 M58 Y59 R61 K62 Y65 K66 R67 K68 Y69 A70 A71 P72 V84 L85 V88 T89 D95 N97 R101 V103 K104 K107 P109 R110 Y111 V117 P118 R119 K120 L121 L122 S123 H124 G125 R126 P128 F129 S130 H132 T150 R152 H153 R154 L168 L177 R179 P181 R183 R184 H186 K188 K215 R219 K220 G226 K235 Y236 I238 R242 K258 P261 Q262 R268 S269 V270 A272 T274 N275	H2 C3 S4 R5 N6 P7 V10 R11 R18 S19 M21 Y22 R24 K25 Y28 K29 R30 K31 Y32 A33 A34 P35 V36 L37 V40 T41 D47 N49 R53 V55 K56 K59 P61 R62 Y63 V69 P70 R71 K72 L73 L74 S75 H76 G77 R78 P80 F81 S82 H84 T102 R104 H105 R106 L120 L129 R131 P133 R135 R136 H138 K140 K167 R171 K172 G178 K187 Y188 I190 R194 K210 P213 Q214 R220 S221 V222 A224 T226 N227

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:3jag, PDBe:3jag, PDBj:3jag
• PDBsum: 3jag
• PubMed: 26245381
• UniProt: G1TG04