Structure of PDB 3j80 Chain E

Receptor sequence

>3j80E (length=260) Species: 28985 (Kluyveromyces lactis)

ARGPKKHLKRLAAPHHWMLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVITLEATNENFRL
VYDVKGRFAVHRITDEEASYKLAKVKKVQLGKKGIPYVVTHDGRTIRYPD
PNIKVNDTVKVDLATGTITDFIKFDTGKLVYVTGGRNLGRVGTIVHRERH
EGGFDLVHIKDSLENTFVTRLNNVFVIGEPGRPWISLPKGKGIKLTISEE
RDRRRAQHGL

3D structure

• PDB: 3j80 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
• Chain: E
• Resolution: 3.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	A2 R3 G4 P5 K7 H8 K10 R11 L12 A13 H16 M19 D21 K22 G25 C26 Y27 A28 P29 R30 A33 G34 K37 L38 R49 N57 G58 R59 A63 M66 R77 K106 R108 K127 K128 L131 G132 K133 K134 G135 Y138 V140 R145 T146 R148 G186 R187 E199 H201 E202 G203 V219 R221 I248 L261	A1 R2 G3 P4 K6 H7 K9 R10 L11 A12 H15 M18 D20 K21 G24 C25 Y26 A27 P28 R29 A32 G33 K36 L37 R48 N56 G57 R58 A62 M65 R76 K105 R107 K126 K127 L130 G131 K132 K133 G134 Y137 V139 R144 T145 R147 G185 R186 E198 H200 E201 G202 V218 R220 I247 L260

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j80, PDBe:3j80, PDBj:3j80
• PDBsum: 3j80
• PubMed: 25417110
• UniProt: Q6CWJ2