Structure of PDB 3hdq Chain E

Receptor sequence

>3hdqE (length=364) Species: 1299 (Deinococcus radiodurans)

ESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDA
GVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPIN
LDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKF
FRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRM
FQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYR
SLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYE
YPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQ
VVAQALATFRRLQG

3D structure

• PDB: 3hdq Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
• Chain: E
• Resolution: 2.36 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R198 R202 R275 R305 E325 Y370 N372
• Catalytic site (residue number reindexed from 1): R173 R177 R250 R280 E300 Y345 N347
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDU	E	I86 H109 F175 F176 Y179 T180 W184 V195 R198 V199 Y209 F210 T294 N296 R305 Y335 Y370	I61 H84 F150 F151 Y154 T155 W159 V170 R173 V174 Y184 F185 T269 N271 R280 Y310 Y345	MOAD: Kd=220uM
BS02	FAD	E	V35 G36 G38 A40 D59 R60 R61 G66 N67 P84 H85 I86 D242 Y243 R364 Y371 N372 M373 V376	V10 G11 G13 A15 D34 R35 R36 G41 N42 P59 H60 I61 D217 Y218 R339 Y346 N347 M348 V351

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3hdq, PDBe:3hdq, PDBj:3hdq
• PDBsum: 3hdq
• PubMed: 19836401
• UniProt: Q9RYF1