Structure of PDB 3gys Chain E

Receptor sequence
>3gysE (length=138) Species: 9685 (Felis catus) [Search protein sequence]
VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSH
GSAQVKAHGQKVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKF
LSHCLLVTLACHHPAEFTPAVHASLDKFFSAVSTVLTS
3D structure
PDB3gys Crystallization of sheep (Ovis aries) and goat (Capra hircus) haemoglobins under unbuffered low-salt conditions
ChainE
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM E Y42 F43 F46 H58 K61 L83 L86 H87 N97 F98 Y42 F43 F46 H58 K61 L83 L86 H87 N97 F98
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3gys, PDBe:3gys, PDBj:3gys
PDBsum3gys
PubMed
UniProtP07405|HBA_FELCA Hemoglobin subunit alpha (Gene Name=HBA)

[Back to BioLiP]