Structure of PDB 3gp9 Chain E

Receptor sequence
>3gp9E (length=132) Species: 212035 (Acanthamoeba polyphaga mimivirus) [Search protein sequence]
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQH
YKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIR
GDLANDIRENLIHASDSEDSAVDEISIWFPET
3D structure
PDB3gp9 Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
ChainE
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K9 Y50 N109 H112 E123
Catalytic site (residue number reindexed from 1) K10 Y51 N110 H113 E124
Enzyme Commision number 2.7.4.6: nucleoside-diphosphate kinase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GDP E K9 Y50 H53 Y58 N62 R86 R99 I106 R107 N109 H112 K10 Y51 H54 Y59 N63 R87 R100 I107 R108 N110 H113
BS02 PO4 E N91 I92 R99 N92 I93 R100
BS03 MG E R86 Q89 H112 A113 R87 Q90 H113 A114
Gene Ontology
Molecular Function
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0006183 GTP biosynthetic process
GO:0006228 UTP biosynthetic process
GO:0006241 CTP biosynthetic process
GO:0009117 nucleotide metabolic process
GO:0009142 nucleoside triphosphate biosynthetic process
GO:0016310 phosphorylation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3gp9, PDBe:3gp9, PDBj:3gp9
PDBsum3gp9
PubMed19439473
UniProtQ5UQL3|NDK_MIMIV Nucleoside diphosphate kinase (Gene Name=NDK)

[Back to BioLiP]