Structure of PDB 3fmt Chain E

Receptor sequence
>3fmtE (length=162) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MKTIEVDDELYSYIASHTKHIGESRSDILRRMLKFSAASQKPVKTIKDKV
RAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRV
YFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQF
PAELIEKVCGTI
3D structure
PDB3fmt Structural insights into the cooperative binding of SeqA to a tandem GATC repeat
ChainE
Resolution2.983 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna E R86 A87 V88 R116 K136 K138 N152 T153 R67 A68 V69 R97 K117 K119 N133 T134
BS02 dna E G115 R116 T117 R118 Y120 Q134 N150 R155 G96 R97 T98 R99 Y101 Q115 N131 R136
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003688 DNA replication origin binding
GO:0005515 protein binding
GO:0010385 double-stranded methylated DNA binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0044729 hemi-methylated DNA-binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007062 sister chromatid cohesion
GO:0008156 negative regulation of DNA replication
GO:0009314 response to radiation
GO:0032297 negative regulation of DNA-templated DNA replication initiation
GO:0090143 nucleoid organization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:1990097 SeqA-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3fmt, PDBe:3fmt, PDBj:3fmt
PDBsum3fmt
PubMed19304745
UniProtP0AFY8|SEQA_ECOLI Negative modulator of initiation of replication (Gene Name=seqA)

[Back to BioLiP]