Structure of PDB 3cjq Chain E |
>3cjqE (length=115) Species: 274 (Thermus thermophilus) [Search protein sequence] |
KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDA IVPVEITIYADRSFTFVTKTPPASYLIRITWEQVLEIAKQKMPLEAAARM IAGSARSMGVEVVGA |
|
PDB | 3cjq Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase. |
Chain | E |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2MM |
E |
K2 K3 |
K1 K2 |
|
|
|
|