Structure of PDB 3cc4 Chain E

Receptor sequence

>3cc4E (length=172) Species: 2238 (Haloarcula marismortui)

PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIE
SDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGD
EVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQ
LTRINDKDVRVFQDGVYITRKP

3D structure

• PDB: 3cc4 Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
• Chain: E
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	Y35 N55 A56 S60 G63 T64 S67 H68 N71 Y82 H90 F91 G109 E110 K111 A112 H119 E139 G142 Q143 A146 Q150 R153 N155 K157 D158 R160 V161 F162	Y35 N55 A56 S60 G63 T64 S67 H68 N71 Y82 H90 F91 G109 E110 K111 A112 H119 E139 G142 Q143 A146 Q150 R153 N155 K157 D158 R160 V161 F162	PDBbind-CN: Kd=100uM

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3cc4, PDBe:3cc4, PDBj:3cc4
• PDBsum: 3cc4
• PubMed: 18455733
• UniProt: P14135|RL6_HALMA Large ribosomal subunit protein uL6 (Gene Name=rpl6)