Structure of PDB 3b6g Chain E

Receptor sequence
>3b6gE (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence]
ATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRI
RGERA
3D structure
PDB3b6g Site selectivity of platinum anticancer therapeutics
ChainE
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 G44 V46 R49 R63 L65 P66 R69 R83 H9 R10 Y11 G14 V16 R19 R33 L35 P36 R39 R53
BS02 dna E G34 V35 K37 Y41 R42 P43 T45 R63 R72 R83 F84 Q85 S86 V117 T118 M120 G4 V5 K7 Y11 R12 P13 T15 R33 R42 R53 F54 Q55 S56 V87 T88 M90
BS03 MN E Q76 D77 Q46 D47
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3b6g, PDBe:3b6g, PDBj:3b6g
PDBsum3b6g
PubMed18157123
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]