Structure of PDB 3aze Chain E

Receptor sequence
>3azeE (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRQLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB3aze Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
ChainE
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 G44 V46 R49 K56 R63 Q64 L65 R69 H3 R4 Y5 G8 V10 R13 K20 R27 Q28 L29 R33
BS02 dna E K37 H39 R40 Y41 R42 P43 R63 R72 R83 F84 Q85 S86 R116 T118 K1 H3 R4 Y5 R6 P7 R27 R36 R47 F48 Q49 S50 R80 T82
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3aze, PDBe:3aze, PDBj:3aze
PDBsum3aze
PubMed21812398
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]