Structure of PDB 3a59 Chain E

Receptor sequence

>3a59E (length=141) Species: 8801 (Struthio camelus)

VLSGTDKTNVKGIFSKISSHAEEYGAETLERMFITYPQTKTYFPHFDLHH
GSAQIKAHGKKVANALIEAVNHIDDISGALSKLSDLHAQKLRVDPVNFKL
LGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGAVLTAKYR

3D structure

• PDB: 3a59 Structure of Hemoglobin from flightless bird (Struthio camelus)
• Chain: E
• Resolution: 3.41 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	E	F43 F46 H58 K61 V62 A65 L83 H87 L91 V93 N97 L101 L136	F43 F46 H58 K61 V62 A65 L83 H87 L91 V93 N97 L101 L136

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3a59, PDBe:3a59, PDBj:3a59
• PDBsum: 3a59
• UniProt: P01981|HBA_STRCA Hemoglobin subunit alpha-A (Gene Name=HBAA)